ATP1B1 antibody (70R-6360)

Rabbit polyclonal ATP1B1 antibody raised against the middle region of ATP1B1

Synonyms Polyclonal ATP1B1 antibody, Anti-ATP1B1 antibody, Atpase Na+/K+ Transporting Beta 1 Polypeptide antibody, ATP1B antibody, MGC1798 antibody
Specificity ATP1B1 antibody was raised against the middle region of ATP1B1
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen ATP1B1 antibody was raised using the middle region of ATP1B1 corresponding to a region with amino acids VMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLL
Assay Information ATP1B1 Blocking Peptide, catalog no. 33R-9698, is also available for use as a blocking control in assays to test for specificity of this ATP1B1 antibody


Western blot analysis using ATP1B1 antibody (70R-6360)

Recommended ATP1B1 Antibody Titration: 0.25ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP1B1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP1B1 belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using ATP1B1 antibody (70R-6360) | Recommended ATP1B1 Antibody Titration: 0.25ug/ml
  • Immunohistochemical staining using ATP1B1 antibody (70R-6360) | NO TEXT
  • Immunohistochemical staining using ATP1B1 antibody (70R-6360) | Human Heart

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors