ATP1B4 antibody (70R-6783)

Rabbit polyclonal ATP1B4 antibody

Synonyms Polyclonal ATP1B4 antibody, Anti-ATP1B4 antibody, beta 4 polypeptide antibody, Na+/K+ Transporting Beta 4 Polypeptide antibody, Na+/K+ transporting, Atpase antibody
Cross Reactivity Human
Applications WB
Immunogen ATP1B4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVKVS
Assay Information ATP1B4 Blocking Peptide, catalog no. 33R-1078, is also available for use as a blocking control in assays to test for specificity of this ATP1B4 antibody

Images

Western Blot analysis using ATP1B4 antibody (70R-6783)

ATP1B4 antibody (70R-6783) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 41 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP1B4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene has been found in all vertebrate genomes sequenced to date. However, this gene has undergone a change in function in placental mammals compared to other species. Specifically, in fish, avian, and amphibian species, this gene encodes plasma membrane-bound beta-subunits of Na,K-ATPase. In placental mammals, the encoded protein interacts with the nuclear transcriptional coregulator SKIP and may be involved in the regulation of TGF-beta signaling. Two transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP1B4 antibody (70R-6783) | ATP1B4 antibody (70R-6783) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors