ATP2A1 antibody (70R-6261)

Rabbit polyclonal ATP2A1 antibody raised against the N terminal of ATP2A1

Synonyms Polyclonal ATP2A1 antibody, Anti-ATP2A1 antibody, SERCA1 antibody, Atpase Ca++ Transporting Cardiac Muscle Fast Twitch 1 antibody, ATP2A antibody
Specificity ATP2A1 antibody was raised against the N terminal of ATP2A1
Cross Reactivity Human
Applications WB
Immunogen ATP2A1 antibody was raised using the N terminal of ATP2A1 corresponding to a region with amino acids MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
Assay Information ATP2A1 Blocking Peptide, catalog no. 33R-5884, is also available for use as a blocking control in assays to test for specificity of this ATP2A1 antibody

Images

Western Blot analysis using ATP2A1 antibody (70R-6261)

ATP2A1 antibody (70R-6261) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 109 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP2A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP2A1 antibody (70R-6261) | ATP2A1 antibody (70R-6261) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors