ATP2B3 antibody (70R-6327)

Rabbit polyclonal ATP2B3 antibody raised against the N terminal of ATP2B3

Synonyms Polyclonal ATP2B3 antibody, Anti-ATP2B3 antibody, PMCA3 antibody, Atpase Ca++ Transporting Plasma Membrane 3 antibody, PMCA3a antibody
Specificity ATP2B3 antibody was raised against the N terminal of ATP2B3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATP2B3 antibody was raised using the N terminal of ATP2B3 corresponding to a region with amino acids GDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEE
Assay Information ATP2B3 Blocking Peptide, catalog no. 33R-3204, is also available for use as a blocking control in assays to test for specificity of this ATP2B3 antibody


Western Blot analysis using ATP2B3 antibody (70R-6327)

ATP2B3 antibody (70R-6327) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 134 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP2B3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP2B3 gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ATP2B3 antibody (70R-6327) | ATP2B3 antibody (70R-6327) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors