ATP2B4 antibody (70R-6379)

Rabbit polyclonal ATP2B4 antibody raised against the middle region of ATP2B4

Synonyms Polyclonal ATP2B4 antibody, Anti-ATP2B4 antibody, PMCA4b antibody, MXRA1 antibody, Atpase Ca++ Transporting Plasma Membrane 4 antibody, PMCA4 antibody, PMCA4x antibody, DKFZp686G08106 antibody, DKFZp686M088 antibody, ATP2B2 antibody
Specificity ATP2B4 antibody was raised against the middle region of ATP2B4
Cross Reactivity Human
Applications WB
Immunogen ATP2B4 antibody was raised using the middle region of ATP2B4 corresponding to a region with amino acids FAGEKFFDIDSGRKAPLHSPPSQHYTIVFNTFVLMQLFNEINSRKIHGEK
Assay Information ATP2B4 Blocking Peptide, catalog no. 33R-2841, is also available for use as a blocking control in assays to test for specificity of this ATP2B4 antibody

Images

Western Blot analysis using ATP2B4 antibody (70R-6379)

ATP2B4 antibody (70R-6379) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 129 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP2B4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP2B4 belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP2B4 antibody (70R-6379) | ATP2B4 antibody (70R-6379) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors