ATP4B antibody (70R-6951)

Rabbit polyclonal ATP4B antibody raised against the middle region of ATP4B

Synonyms Polyclonal ATP4B antibody, Anti-ATP4B antibody, Atpase H+/K+ Exchanging Beta Polypeptide antibody, ATP6B antibody
Specificity ATP4B antibody was raised against the middle region of ATP4B
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen ATP4B antibody was raised using the middle region of ATP4B corresponding to a region with amino acids QVKYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNIPRNAEVAIVCK
Assay Information ATP4B Blocking Peptide, catalog no. 33R-7776, is also available for use as a blocking control in assays to test for specificity of this ATP4B antibody

Images

Western Blot analysis using ATP4B antibody (70R-6951)

ATP4B antibody (70R-6951) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP4B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP4B belongs to a family of P-type cation-transporting ATPases. The gastric H+, K+-ATPase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of ATP coupled with the exchange of H(+) and K(+) ions across the plasma membrane. It is also responsible for gastric acid secretion.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP4B antibody (70R-6951) | ATP4B antibody (70R-6951) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors