ATP6AP1 antibody (70R-4520)

Rabbit polyclonal ATP6AP1 antibody raised against the middle region of ATP6AP1

Synonyms Polyclonal ATP6AP1 antibody, Anti-ATP6AP1 antibody, ATP6IP1 antibody, Ac45 antibody, ATP6S1 antibody, CF2 antibody, VATPS1 antibody, XAP3 antibody, Atpase H+ Transporting Lysosomal Accessory Protein 1 antibody, XAP-3 antibody, 16A antibody, MGC129781 antibody
Specificity ATP6AP1 antibody was raised against the middle region of ATP6AP1
Cross Reactivity Human
Applications WB
Immunogen ATP6AP1 antibody was raised using the middle region of ATP6AP1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS
Assay Information ATP6AP1 Blocking Peptide, catalog no. 33R-8700, is also available for use as a blocking control in assays to test for specificity of this ATP6AP1 antibody

Images

Western Blot analysis using ATP6AP1 antibody (70R-4520)

ATP6AP1 antibody (70R-4520) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6AP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kDa and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP6AP1 antibody (70R-4520) | ATP6AP1 antibody (70R-4520) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors