ATP6V0A1 antibody (70R-6858)

Rabbit polyclonal ATP6V0A1 antibody raised against the N terminal of ATP6V0A1

Synonyms Polyclonal ATP6V0A1 antibody, Anti-ATP6V0A1 antibody, Vph1 antibody, DKFZp781J1951 antibody, Stv1 antibody, ATP6N1A antibody, Atpase H+ Transporting Lysosomal V0 Subunit A1 antibody, ATP6N1 antibody, a1 antibody, VPP1 antibody
Specificity ATP6V0A1 antibody was raised against the N terminal of ATP6V0A1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATP6V0A1 antibody was raised using the N terminal of ATP6V0A1 corresponding to a region with amino acids RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE
Assay Information ATP6V0A1 Blocking Peptide, catalog no. 33R-7853, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A1 antibody

Images

Western blot analysis using ATP6V0A1 antibody (70R-6858)

Recommended ATP6V0A1 Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 96 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6V0A1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP6V0A1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. ATP6V0A1 is one of three A subunit proteins and it is associated with clathrin-coated vesicles.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using ATP6V0A1 antibody (70R-6858) | Recommended ATP6V0A1 Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors