ATP6V0A2 antibody (70R-5999)

Rabbit polyclonal ATP6V0A2 antibody raised against the N terminal of ATP6V0A2

Synonyms Polyclonal ATP6V0A2 antibody, Anti-ATP6V0A2 antibody, J6B7 antibody, TJ6 antibody, Vph1 antibody, TJ6M antibody, TJ6s antibody, a2 antibody, Atpase H+ Transporting Lysosomal V0 Subunit A2 antibody, Stv1 antibody, ATP6N1D antibody, ATP6a2 antibody
Specificity ATP6V0A2 antibody was raised against the N terminal of ATP6V0A2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATP6V0A2 antibody was raised using the N terminal of ATP6V0A2 corresponding to a region with amino acids INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN
Assay Information ATP6V0A2 Blocking Peptide, catalog no. 33R-4080, is also available for use as a blocking control in assays to test for specificity of this ATP6V0A2 antibody

Images

Immunohistochemical staining using ATP6V0A2 antibody (70R-5999)

ATP6V0A2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 98 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6V0A2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The multisubunit vacuolar-type proton pump (H(+)-ATPase or V-ATPase) is essential for acidification of diverse cellular components, including endosomes, lysosomes, clathrin-coated vesicles, secretory vesicles, and chromaffin granules, and it is found at high density in the plasma membrane of certain specialized cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using ATP6V0A2 antibody (70R-5999) | ATP6V0A2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using ATP6V0A2 antibody (70R-5999) | ATP6V0A2 antibody (70R-5999) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors