ATP6V0C antibody (70R-6564)

Rabbit polyclonal ATP6V0C antibody raised against the middle region of ATP6V0C

Synonyms Polyclonal ATP6V0C antibody, Anti-ATP6V0C antibody, ATPL antibody, VATL antibody, ATP6L antibody, Atpase H+ Transporting Lysosomal 16Kda V0 Subunit C antibody, ATP6C antibody, Vma3 antibody
Specificity ATP6V0C antibody was raised against the middle region of ATP6V0C
Cross Reactivity Human
Applications WB
Immunogen ATP6V0C antibody was raised using the middle region of ATP6V0C corresponding to a region with amino acids VVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
Assay Information ATP6V0C Blocking Peptide, catalog no. 33R-9868, is also available for use as a blocking control in assays to test for specificity of this ATP6V0C antibody

Images

Western Blot analysis using ATP6V0C antibody (70R-6564)

ATP6V0C antibody (70R-6564) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6V0C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP6V0C antibody (70R-6564) | ATP6V0C antibody (70R-6564) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors