ATP6V0D2 antibody (70R-2353)

Rabbit polyclonal ATP6V0D2 antibody raised against the middle region of ATP6V0D2

Synonyms Polyclonal ATP6V0D2 antibody, Anti-ATP6V0D2 antibody, VMA6 antibody, FLJ38708 antibody, ATP6D2 antibody, Atpase H+ Transporting Lysosomal 38Kda V0 Subunit D2 antibody
Specificity ATP6V0D2 antibody was raised against the middle region of ATP6V0D2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ATP6V0D2 antibody was raised using the middle region of ATP6V0D2 corresponding to a region with amino acids GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
Assay Information ATP6V0D2 Blocking Peptide, catalog no. 33R-3417, is also available for use as a blocking control in assays to test for specificity of this ATP6V0D2 antibody

Images

Western Blot analysis using ATP6V0D2 antibody (70R-2353)

ATP6V0D2 antibody (70R-2353) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATP6V0D2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ATP6V0D2 is the subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. ATP6V0D2 may play a role in coupling of proton transport and ATP hydrolysis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ATP6V0D2 antibody (70R-2353) | ATP6V0D2 antibody (70R-2353) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors