ATPIF1 antibody (70R-5303)

Rabbit polyclonal ATPIF1 antibody raised against the N terminal of ATPIF1

Synonyms Polyclonal ATPIF1 antibody, Anti-ATPIF1 antibody, MGC8898 antibody, ATPIP antibody, IP antibody, ATPI antibody, Atpase Inhibitory Factor 1 antibody, MGC1167 antibody
Specificity ATPIF1 antibody was raised against the N terminal of ATPIF1
Cross Reactivity Human
Applications WB
Immunogen ATPIF1 antibody was raised using the N terminal of ATPIF1 corresponding to a region with amino acids GSIREAGGAFGKREQAEEERYFRAQSREQLAALKKHHEEEIVHHKKEIER
Assay Information ATPIF1 Blocking Peptide, catalog no. 33R-3567, is also available for use as a blocking control in assays to test for specificity of this ATPIF1 antibody


Western Blot analysis using ATPIF1 antibody (70R-5303)

ATPIF1 antibody (70R-5303) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ATPIF1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a mitochondrial ATPase inhibitor. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ATPIF1 antibody (70R-5303) | ATPIF1 antibody (70R-5303) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors