AWAT1 antibody (70R-6781)

Rabbit polyclonal AWAT1 antibody raised against the N terminal of AWAT1

Synonyms Polyclonal AWAT1 antibody, Anti-AWAT1 antibody, AWAT1 antibody, Acyl-Coa Wax Alcohol Acyltransferase 1 antibody, DGA2 antibody
Specificity AWAT1 antibody was raised against the N terminal of AWAT1
Cross Reactivity Human
Applications WB
Immunogen AWAT1 antibody was raised using the N terminal of AWAT1 corresponding to a region with amino acids NWCVWTHIRDYFPITILKTKDLSPEHNYLMGVHPHGLLTFGAFCNFCTEA
Assay Information AWAT1 Blocking Peptide, catalog no. 33R-6931, is also available for use as a blocking control in assays to test for specificity of this AWAT1 antibody

Images

Western Blot analysis using AWAT1 antibody (70R-6781)

AWAT1 antibody (70R-6781) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AWAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene belongs to the diacylglycerol acyltransferase family. It esterifies long chain (wax) alcohols with acyl-CoA-derived fatty acids to produce wax esters. Wax esters are enriched in sebum, suggesting that this enzyme plays a central role in lipid metabolism in skin. Consistent with this observation, this protein is predominantly expressed in the sebaceous gland of the skin.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AWAT1 antibody (70R-6781) | AWAT1 antibody (70R-6781) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors