AXUD1 antibody (70R-3233)

Rabbit polyclonal AXUD1 antibody raised against the middle region of AXUD1

Synonyms Polyclonal AXUD1 antibody, Anti-AXUD1 antibody, DKFZp566F164 antibody, TAIP-3 antibody, URAX1 antibody, FAM130B antibody, Cysteine-Serine-Rich Nuclear Protein 1 antibody
Specificity AXUD1 antibody was raised against the middle region of AXUD1
Cross Reactivity Human
Applications WB
Immunogen AXUD1 antibody was raised using the middle region of AXUD1 corresponding to a region with amino acids ARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAK
Assay Information AXUD1 Blocking Peptide, catalog no. 33R-1498, is also available for use as a blocking control in assays to test for specificity of this AXUD1 antibody

Images

Western Blot analysis using AXUD1 antibody (70R-3233)

AXUD1 antibody (70R-3233) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AXUD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that localizes to the nucleus and expression of this gene is induced in response to elevated levels of axin. The Wnt signalling pathway, which is negatively regulated by axin, is important in axis formation in early development and impaired regulation of this signalling pathway is often involved in tumors. A decreased level of expression of this gene in tumors compared to the level of expression in their corresponding normal tissues suggests that this gene product has a tumor suppressor function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AXUD1 antibody (70R-3233) | AXUD1 antibody (70R-3233) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors