AZGP1 antibody (70R-6086)

Rabbit polyclonal AZGP1 antibody raised against the N terminal of AZGP1

Synonyms Polyclonal AZGP1 antibody, Anti-AZGP1 antibody, ZA2G antibody, ZAG antibody, Alpha-2-Glycoprotein 1 Zinc-Binding antibody
Specificity AZGP1 antibody was raised against the N terminal of AZGP1
Cross Reactivity Human
Applications WB
Immunogen AZGP1 antibody was raised using the N terminal of AZGP1 corresponding to a region with amino acids KVAQYMADVLEDSKDKVQENLLANGVDLVTYITRFQWDMAKYPIKQSLKN
Assay Information AZGP1 Blocking Peptide, catalog no. 33R-4700, is also available for use as a blocking control in assays to test for specificity of this AZGP1 antibody

Images

Western Blot analysis using AZGP1 antibody (70R-6086)

AZGP1 antibody (70R-6086) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of AZGP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Stimulates lipid degradation in adipocytes and causes the extensive fat losses associated with some advanced cancers. AZGP1 may bind polyunsaturated fatty acids.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using AZGP1 antibody (70R-6086) | AZGP1 antibody (70R-6086) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors