B3GALNT1 antibody (70R-6346)

Rabbit polyclonal B3GALNT1 antibody

Synonyms Polyclonal B3GALNT1 antibody, Anti-B3GALNT1 antibody, P antibody, B3GALT3 antibody, galT3 antibody, Globoside Blood Group antibody, Gb4Cer antibody, beta3Gal-T3 antibody, BGAL-3, Beta 13-N-Acetylgalactosaminyltransferase 1 antibody, BGAL 3 antibody, BGAL 3, GLCT3 antibody, GLOB antibody, P1 antibody, BGAL-3 antibody, B3GAL
Cross Reactivity Human
Applications WB
Immunogen B3GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC
Assay Information B3GALNT1 Blocking Peptide, catalog no. 33R-7328, is also available for use as a blocking control in assays to test for specificity of this B3GALNT1 antibody

Images

Western Blot analysis using B3GALNT1 antibody (70R-6346)

B3GALNT1 antibody (70R-6346) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GALNT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using B3GALNT1 antibody (70R-6346) | B3GALNT1 antibody (70R-6346) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors