B3GALNT2 antibody (70R-5374)

Rabbit polyclonal B3GALNT2 antibody raised against the middle region of B3GALNT2

Synonyms Polyclonal B3GALNT2 antibody, Anti-B3GALNT2 antibody, BGAL-3 antibody, MGC39558 antibody, BGAL 3 antibody, BGAL-3, Beta 13-N-Acetylgalactosaminyltransferase 2 antibody, B3GAL, B3GalNAc-T2 antibody, BGAL 3
Specificity B3GALNT2 antibody was raised against the middle region of B3GALNT2
Cross Reactivity Human,Mouse
Applications WB
Immunogen B3GALNT2 antibody was raised using the middle region of B3GALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL
Assay Information B3GALNT2 Blocking Peptide, catalog no. 33R-7062, is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody


Western Blot analysis using B3GALNT2 antibody (70R-5374)

B3GALNT2 antibody (70R-5374) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GALNT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using B3GALNT2 antibody (70R-5374) | B3GALNT2 antibody (70R-5374) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors