B3GALT1 antibody (70R-7176)

Rabbit polyclonal B3GALT1 antibody raised against the N terminal of B3GALT1

Synonyms Polyclonal B3GALT1 antibody, Anti-B3GALT1 antibody, B3GAL, BGAL 3, BGAL 3 antibody, MGC126594 antibody, BGAL-3, BGAL-3 antibody, Beta 13-Galactosyltransferase Polypeptide 1 antibody, beta3Gal-T1 antibody
Specificity B3GALT1 antibody was raised against the N terminal of B3GALT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen B3GALT1 antibody was raised using the N terminal of B3GALT1 corresponding to a region with amino acids MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF
Assay Information B3GALT1 Blocking Peptide, catalog no. 33R-5750, is also available for use as a blocking control in assays to test for specificity of this B3GALT1 antibody


Western Blot analysis using B3GALT1 antibody (70R-7176)

B3GALT1 antibody (70R-7176) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GALT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance B3GALT1 is a member of the beta-1,3-galactosyltransferase (beta3GalT) family. This family are type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using B3GALT1 antibody (70R-7176) | B3GALT1 antibody (70R-7176) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors