B3GALT6 antibody (70R-7242)

Rabbit polyclonal B3GALT6 antibody raised against the C terminal of B3GALT6

Synonyms Polyclonal B3GALT6 antibody, Anti-B3GALT6 antibody, Beta 13-Galactosyltransferase Polypeptide 6 antibody, BGAL 3 antibody, BGAL 3, BGAL-3 antibody, BGAL-3, B3GAL, beta3GalT6 antibody
Specificity B3GALT6 antibody was raised against the C terminal of B3GALT6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen B3GALT6 antibody was raised using the C terminal of B3GALT6 corresponding to a region with amino acids VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE
Assay Information B3GALT6 Blocking Peptide, catalog no. 33R-9759, is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody

Images

Western Blot analysis using B3GALT6 antibody (70R-7242)

B3GALT6 antibody (70R-7242) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GALT6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using B3GALT6 antibody (70R-7242) | B3GALT6 antibody (70R-7242) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors