B3GALT6 antibody (70R-7452)

Rabbit polyclonal B3GALT6 antibody raised against the N terminal of B3GALT6

Synonyms Polyclonal B3GALT6 antibody, Anti-B3GALT6 antibody, Beta 13-Galactosyltransferase Polypeptide 6 antibody, BGAL 3 antibody, BGAL 3, BGAL-3 antibody, beta3GalT6 antibody, BGAL-3, B3GAL
Specificity B3GALT6 antibody was raised against the N terminal of B3GALT6
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen B3GALT6 antibody was raised using the N terminal of B3GALT6 corresponding to a region with amino acids EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
Assay Information B3GALT6 Blocking Peptide, catalog no. 33R-2691, is also available for use as a blocking control in assays to test for specificity of this B3GALT6 antibody


Western Blot analysis using B3GALT6 antibody (70R-7452)

B3GALT6 antibody (70R-7452) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GALT6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance B3GALT6 (Beta-1,3-galactosyltransferase) transfers galactose from UDP-galactose to substrates with a terminal beta-linked galactose residue. It has a preference for galactose-beta-1,4-xylose that is found in the linker region of glycosaminoglycans, such as heparan sulfate and chondroitin sulfate. It has no activity towards substrates with terminal glucosamine or galactosamine residues.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using B3GALT6 antibody (70R-7452) | B3GALT6 antibody (70R-7452) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors