B3GALTL antibody (70R-7243)

Rabbit polyclonal B3GALTL antibody raised against the middle region of B3GALTL

Synonyms Polyclonal B3GALTL antibody, Anti-B3GALTL antibody, Gal-T antibody, beta3Glc-T antibody, BGAL 3, BGAL 3 antibody, B3GAL, Beta 13-Galactosyltransferase-Like antibody, B3GTL antibody, B3Glc-T antibody, BGAL-3, BGAL-3 antibody
Specificity B3GALTL antibody was raised against the middle region of B3GALTL
Cross Reactivity Human
Applications WB
Immunogen B3GALTL antibody was raised using the middle region of B3GALTL corresponding to a region with amino acids DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE
Assay Information B3GALTL Blocking Peptide, catalog no. 33R-2243, is also available for use as a blocking control in assays to test for specificity of this B3GALTL antibody

Images

Western Blot analysis using B3GALTL antibody (70R-7243)

B3GALTL antibody (70R-7243) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GALTL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance B3GALTL is the O-fucosyltransferase that transfers glucose toward fucose with a beta-1,3 linkage. B3GALTL specifically glucosylates O-linked fucosylglycan on TSP type-1 domains of proteins, thereby contributing to elongation of O-fucosylglycan.B3GALTL is a beta-1,3-glucosyltransferase involved in the synthesis of the unusual O-linked disaccharide glucosyl-beta-1,3-fucose-O- found on the thrombospondin type-1 repeats (TSRs) of many biologically important proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using B3GALTL antibody (70R-7243) | B3GALTL antibody (70R-7243) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors