B3GAT3 antibody (70R-6768)

Rabbit polyclonal B3GAT3 antibody

Synonyms Polyclonal B3GAT3 antibody, Anti-B3GAT3 antibody, BGAT 3, B3GAT, Glucuronosyltransferase I antibody, Beta 13-Glucuronyltransferase 3 antibody, BGAT 3 antibody, GlcAT-I antibody, BGAT-3 antibody, BGAT-3, GLCATI antibody
Cross Reactivity Human
Applications WB
Immunogen B3GAT3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPLRAAAEQLRQKDLRISQLQAELRRPPPAPAQPPEPEALPTIYVVTPTY
Assay Information B3GAT3 Blocking Peptide, catalog no. 33R-7265, is also available for use as a blocking control in assays to test for specificity of this B3GAT3 antibody

Images

Western Blot analysis using B3GAT3 antibody (70R-6768)

B3GAT3 antibody (70R-6768) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B3GAT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the glucuronyltransferase gene family, enzymes that exhibit strict acceptor specificity, recognizing nonreducing terminal sugars and their anomeric linkages. This gene product catalyzes the formation of the glycosaminoglycan-protein linkage by way of a glucuronyl transfer reaction in the final step of the biosynthesis of the linkage region of proteoglycans.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using B3GAT3 antibody (70R-6768) | B3GAT3 antibody (70R-6768) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors