B4GALNT1 antibody (70R-6756)

Rabbit polyclonal B4GALNT1 antibody raised against the middle region of B4GALNT1

Synonyms Polyclonal B4GALNT1 antibody, Anti-B4GALNT1 antibody, BGAL-4, Beta 14-N-Acetyl-Galactosaminyl Transferase 1 antibody, B4GAL, BGAL 4, BGAL-4 antibody, BGAL 4 antibody, GALNACT antibody, GALGT antibody
Specificity B4GALNT1 antibody was raised against the middle region of B4GALNT1
Cross Reactivity Human
Applications WB
Immunogen B4GALNT1 antibody was raised using the middle region of B4GALNT1 corresponding to a region with amino acids GLGSLRVGSCSDVVVDHASKLKLPWTSRDAGAETYARYRYPGSLDESQMA
Assay Information B4GALNT1 Blocking Peptide, catalog no. 33R-3395, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody

Images

Western Blot analysis using B4GALNT1 antibody (70R-6756)

B4GALNT1 antibody (70R-6756) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B4GALNT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using B4GALNT1 antibody (70R-6756) | B4GALNT1 antibody (70R-6756) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors