B4GALNT1 antibody (70R-7378)

Rabbit polyclonal B4GALNT1 antibody raised against the N terminal of B4GALNT1

Synonyms Polyclonal B4GALNT1 antibody, Anti-B4GALNT1 antibody, GALGT antibody, BGAL-4, Beta 14-N-Acetyl-Galactosaminyl Transferase 1 antibody, BGAL 4, GALNACT antibody, B4GAL, BGAL 4 antibody, BGAL-4 antibody
Specificity B4GALNT1 antibody was raised against the N terminal of B4GALNT1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen B4GALNT1 antibody was raised using the N terminal of B4GALNT1 corresponding to a region with amino acids APWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGG
Assay Information B4GALNT1 Blocking Peptide, catalog no. 33R-1441, is also available for use as a blocking control in assays to test for specificity of this B4GALNT1 antibody


Western Blot analysis using B4GALNT1 antibody (70R-7378)

B4GALNT1 antibody (70R-7378) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B4GALNT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. B4GALNT1(GalNAc-T) catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively.GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using B4GALNT1 antibody (70R-7378) | B4GALNT1 antibody (70R-7378) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors