B4GALT2 antibody (70R-6780)

Rabbit polyclonal B4GALT2 antibody raised against the middle region of B4GALT2

Synonyms Polyclonal B4GALT2 antibody, Anti-B4GALT2 antibody, beta4Gal-T2 antibody, BGAL 4, Beta 14-Galactosyltransferase Polypeptide 2 antibody, BGAL-4, BGAL-4 antibody, B4GAL, BGAL 4 antibody, B4Gal-T2 antibody, B4Gal-T3 antibody
Specificity B4GALT2 antibody was raised against the middle region of B4GALT2
Cross Reactivity Human
Applications WB
Immunogen B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids NRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKR
Assay Information B4GALT2 Blocking Peptide, catalog no. 33R-6856, is also available for use as a blocking control in assays to test for specificity of this B4GALT2 antibody


Western Blot analysis using B4GALT2 antibody (70R-6780)

B4GALT2 antibody (70R-6780) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B4GALT2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using B4GALT2 antibody (70R-6780) | B4GALT2 antibody (70R-6780) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors