B4GALT3 antibody (70R-7312)

Rabbit polyclonal B4GALT3 antibody raised against the middle region of B4GALT3

Synonyms Polyclonal B4GALT3 antibody, Anti-B4GALT3 antibody, BGAL 4 antibody, beta4Gal-T3 antibody, BGAL-4 antibody, BGAL 4, B4GAL, Beta 14-Galactosyltransferase Polypeptide 3 antibody, BGAL-4
Specificity B4GALT3 antibody was raised against the middle region of B4GALT3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen B4GALT3 antibody was raised using the middle region of B4GALT3 corresponding to a region with amino acids MVKHRGDKGNEENPHRFDLLVRTQNSWTQDGMNSLTYQLLARELGPLYTN
Assay Information B4GALT3 Blocking Peptide, catalog no. 33R-6588, is also available for use as a blocking control in assays to test for specificity of this B4GALT3 antibody

Images

Western Blot analysis using B4GALT3 antibody (70R-7312)

B4GALT3 antibody (70R-7312) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B4GALT3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using B4GALT3 antibody (70R-7312) | B4GALT3 antibody (70R-7312) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors