BACE1 antibody (70R-7276)

Rabbit polyclonal BACE1 antibody raised against the N terminal of BACE1

Synonyms Polyclonal BACE1 antibody, Anti-BACE1 antibody, BACE -1, BACE -1 antibody, Beta-Site App-Cleaving Enzyme 1 antibody, BACE 1 antibody, FLJ90568 antibody, BACE antibody, BACE 1, BACE1, HSPC104 antibody, ASP2 antibody, KIAA1149 antibody
Specificity BACE1 antibody was raised against the N terminal of BACE1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BACE1 antibody was raised using the N terminal of BACE1 corresponding to a region with amino acids GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY
Assay Information BACE1 Blocking Peptide, catalog no. 33R-3496, is also available for use as a blocking control in assays to test for specificity of this BACE1 antibody

Images

Immunofluorescent staining using BACE1 antibody (70R-7276)

BACE1 antibody used at a concentration of 2-10 ug/ml to detect astrocytes in rodent brain (red). Nuclei staining with DAPI.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BACE1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein (APP) by two proteases, one of which is the protein. BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunofluorescent staining using BACE1 antibody (70R-7276) | BACE1 antibody used at a concentration of 2-10 ug/ml to detect astrocytes in rodent brain (red). Nuclei staining with DAPI.
  • Western Blot analysis using BACE1 antibody (70R-7276) | BACE1 antibody (70R-7276) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using BACE1 antibody (70R-7276) | BACE1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors