BACE2 antibody (70R-6662)

Rabbit polyclonal BACE2 antibody raised against the N terminal of BACE2

Synonyms Polyclonal BACE2 antibody, Anti-BACE2 antibody, BAE2 antibody, ASP1 antibody, CDA13 antibody, BACE2, BACE-2 antibody, CEAP1 antibody, BACE 2, DRAP antibody, AEPLC antibody, ASP21 antibody, BACE-2, BACE 2 antibody, Beta-Site App-Cleaving Enzyme 2 antibody, ALP56 antibody
Specificity BACE2 antibody was raised against the N terminal of BACE2
Cross Reactivity Human
Applications WB
Immunogen BACE2 antibody was raised using the N terminal of BACE2 corresponding to a region with amino acids PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAG
Assay Information BACE2 Blocking Peptide, catalog no. 33R-6958, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody

Images

Western Blot analysis using BACE2 antibody (70R-6662)

BACE2 antibody (70R-6662) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BACE2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BACE2 antibody (70R-6662) | BACE2 antibody (70R-6662) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors