BAT1 antibody (70R-5022)

Rabbit polyclonal BAT1 antibody raised against the N terminal of BAT1

Synonyms Polyclonal BAT1 antibody, Anti-BAT1 antibody, Hla-B Associated Transcript 1 antibody, UAP56 antibody, DDX39B antibody, D6S81E antibody
Specificity BAT1 antibody was raised against the N terminal of BAT1
Cross Reactivity Human
Applications WB
Immunogen BAT1 antibody was raised using the N terminal of BAT1 corresponding to a region with amino acids MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDF
Assay Information BAT1 Blocking Peptide, catalog no. 33R-5641, is also available for use as a blocking control in assays to test for specificity of this BAT1 antibody

Images

Western Blot analysis using BAT1 antibody (70R-5022)

BAT1 antibody (70R-5022) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 49 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BAT1 is a member of the DEAD protein family of ATP-dependent RNA helicases. Members of this family are involved in a number of cellular functions including initiation of translation, RNA splicing, and ribosome assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BAT1 antibody (70R-5022) | BAT1 antibody (70R-5022) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors