BAT5 antibody (70R-6310)

Rabbit polyclonal BAT5 antibody raised against the middle region of BAT5

Synonyms Polyclonal BAT5 antibody, Anti-BAT5 antibody, D6S82E antibody, NG26 antibody, Hla-B Associated Transcript 5 antibody
Specificity BAT5 antibody was raised against the middle region of BAT5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL
Assay Information BAT5 Blocking Peptide, catalog no. 33R-7812, is also available for use as a blocking control in assays to test for specificity of this BAT5 antibody

Images

Western Blot analysis using BAT5 antibody (70R-6310)

BAT5 antibody (70R-6310) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BAT5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BAT5 antibody (70R-6310) | BAT5 antibody (70R-6310) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors