BCAP29 antibody (70R-7550)

Rabbit polyclonal BCAP29 antibody raised against the middle region of BCAP29

Synonyms Polyclonal BCAP29 antibody, Anti-BCAP29 antibody, B-Cell Receptor-Associated Protein 29 antibody, BAP29 antibody, DKFZp686M2086 antibody
Specificity BCAP29 antibody was raised against the middle region of BCAP29
Cross Reactivity Human
Applications WB
Immunogen BCAP29 antibody was raised using the middle region of BCAP29 corresponding to a region with amino acids GVMEPQQRNADSHQKLEEAKNRFFPRASSSRSMALQIPIKLILDFLASRT
Assay Information BCAP29 Blocking Peptide, catalog no. 33R-3644, is also available for use as a blocking control in assays to test for specificity of this BCAP29 antibody

Images

Western Blot analysis using BCAP29 antibody (70R-7550)

BCAP29 antibody (70R-7550) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCAP29 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BCAP29 may play a role in anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi. BCAP29 may be involved in CASP8-mediated apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BCAP29 antibody (70R-7550) | BCAP29 antibody (70R-7550) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors