BCAP31 antibody (70R-6009)

Rabbit polyclonal BCAP31 antibody raised against the middle region of BCAP31

Synonyms Polyclonal BCAP31 antibody, Anti-BCAP31 antibody, CDM antibody, 6C6-AG antibody, DXS1357E antibody, B-Cell Receptor-Associated Protein 31 antibody, BAP31 antibody
Specificity BCAP31 antibody was raised against the middle region of BCAP31
Cross Reactivity Human
Applications WB
Immunogen BCAP31 antibody was raised using the middle region of BCAP31 corresponding to a region with amino acids STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
Assay Information BCAP31 Blocking Peptide, catalog no. 33R-8871, is also available for use as a blocking control in assays to test for specificity of this BCAP31 antibody

Images

Western Blot analysis using BCAP31 antibody (70R-6009)

BCAP31 antibody (70R-6009) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCAP31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BCAP31 is a member of the B-cell receptor associated protein 31 superfamily. It is a multi-pass transmembrane protein of the endoplasmic reticulum that is involved in the anterograde transport of membrane proteins from the endoplasmic reticulum to the Golgi and in the caspase 8-mediated apoptosis. Microdeletions in this gene are associated with the contiguous ABCD1/DXS1375E deletion syndrome.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BCAP31 antibody (70R-6009) | BCAP31 antibody (70R-6009) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors