BCAT1 antibody (70R-5566)

Rabbit polyclonal BCAT1 antibody raised against the N terminal of BCAT1

Synonyms Polyclonal BCAT1 antibody, Anti-BCAT1 antibody, Branched Chain Aminotransferase 1 Cytosolic antibody, MECA39 antibody, DKFZp686E12175 antibody, ECA39 antibody, BCT1 antibody, PNAS-121 antibody
Specificity BCAT1 antibody was raised against the N terminal of BCAT1
Cross Reactivity Human
Applications WB
Immunogen BCAT1 antibody was raised using the N terminal of BCAT1 corresponding to a region with amino acids MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG
Assay Information BCAT1 Blocking Peptide, catalog no. 33R-6125, is also available for use as a blocking control in assays to test for specificity of this BCAT1 antibody


Western Blot analysis using BCAT1 antibody (70R-5566)

BCAT1 antibody (70R-5566) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCAT1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes the cytosolic form of the enzyme branched-chain amino acid transaminase. This enzyme catalyzes the reversible transamination of branched-chain alpha-keto acids to branched-chain L-amino acids essential for cell growth.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BCAT1 antibody (70R-5566) | BCAT1 antibody (70R-5566) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors