BCKDK antibody (70R-3675)

Rabbit polyclonal BCKDK antibody raised against the N terminal of BCKDK

Synonyms Polyclonal BCKDK antibody, Anti-BCKDK antibody, Branched Chain Ketoacid Dehydrogenase Kinase antibody
Specificity BCKDK antibody was raised against the N terminal of BCKDK
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD
Assay Information BCKDK Blocking Peptide, catalog no. 33R-1742, is also available for use as a blocking control in assays to test for specificity of this BCKDK antibody

Images

Western Blot analysis using BCKDK antibody (70R-3675)

BCKDK antibody (70R-3675) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BCKDK antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BCkDaK belongs to the PDK/BCkDaK protein kinase family. It contains 1 histidine kinase domain. BCkDaK catalyzes the phosphorylation and inactivation of the branched-chain alpha-ketoacid dehydrogenase complex, the key regulatory enzyme of the valine, leucine and isoleucine catabolic pathways. BCkDaK is the key enzyme that regulates the activity state of the BCkDa complex.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BCKDK antibody (70R-3675) | BCKDK antibody (70R-3675) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors