BDNF antibody (70R-6209)

Rabbit polyclonal BDNF antibody raised against the middle region of BDNF

Synonyms Polyclonal BDNF antibody, Anti-BDNF antibody, MGC34632 antibody, Brain-Derived Neurotrophic Factor antibody
Specificity BDNF antibody was raised against the middle region of BDNF
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen BDNF antibody was raised using the middle region of BDNF corresponding to a region with amino acids EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Assay Information BDNF Blocking Peptide, catalog no. 33R-2813, is also available for use as a blocking control in assays to test for specificity of this BDNF antibody

Images

Western Blot analysis using BDNF antibody (70R-6209)

BDNF antibody (70R-6209) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BDNF antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BDNF antibody (70R-6209) | BDNF antibody (70R-6209) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors