BECN1 antibody (70R-5935)

Rabbit polyclonal BECN1 antibody raised against the N terminal of BECN1

Synonyms Polyclonal BECN1 antibody, Anti-BECN1 antibody, VPS30 antibody, beclin1 antibody, Beclin 1 Autophagy Related antibody, ATG6 antibody
Specificity BECN1 antibody was raised against the N terminal of BECN1
Cross Reactivity Human
Applications WB
Immunogen BECN1 antibody was raised using the N terminal of BECN1 corresponding to a region with amino acids MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL
Assay Information BECN1 Blocking Peptide, catalog no. 33R-6603, is also available for use as a blocking control in assays to test for specificity of this BECN1 antibody

Images

Western Blot analysis using BECN1 antibody (70R-5935)

BECN1 antibody (70R-5935) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BECN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BECN1 antibody (70R-5935) | BECN1 antibody (70R-5935) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors