BEND7 antibody (70R-3881)

Rabbit polyclonal BEND7 antibody raised against the middle region of BEND7

Synonyms Polyclonal BEND7 antibody, Anti-BEND7 antibody, MGC35247 antibody, FLJ40283 antibody, Ben Domain Containing 7 antibody
Specificity BEND7 antibody was raised against the middle region of BEND7
Cross Reactivity Human
Applications WB
Immunogen BEND7 antibody was raised using the middle region of BEND7 corresponding to a region with amino acids LGFGIVLESPSSDPEVQLAEGFDVFMPKSQLDSILSNYTRSGSLLFRKLV
Assay Information BEND7 Blocking Peptide, catalog no. 33R-4971, is also available for use as a blocking control in assays to test for specificity of this BEND7 antibody

Images

Western Blot analysis using BEND7 antibody (70R-3881)

BEND7 antibody (70R-3881) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BEND7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of BEND protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BEND7 antibody (70R-3881) | BEND7 antibody (70R-3881) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors