BEST3 antibody (70R-5135)

Rabbit polyclonal BEST3 antibody raised against the N terminal of BEST3

Synonyms Polyclonal BEST3 antibody, Anti-BEST3 antibody, Bestrophin 3 antibody, MGC40411 antibody, MGC13168 antibody, VMD2L3 antibody
Specificity BEST3 antibody was raised against the N terminal of BEST3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BEST3 antibody was raised using the N terminal of BEST3 corresponding to a region with amino acids PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMK
Assay Information BEST3 Blocking Peptide, catalog no. 33R-7214, is also available for use as a blocking control in assays to test for specificity of this BEST3 antibody


Western Blot analysis using BEST3 antibody (70R-5135)

BEST3 antibody (70R-5135) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BEST3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BEST3 belongs to the bestrophin family of anion channels, which includes BEST1, the gene mutant in vitelliform macular dystrophy, and 2 other BEST1-like genes, BEST2 and BEST4.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BEST3 antibody (70R-5135) | BEST3 antibody (70R-5135) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors