beta 2 Microglobulin antibody (70R-5904)

Rabbit polyclonal beta 2 Microglobulin antibody raised against the N terminal of B2M

Synonyms Polyclonal beta 2 Microglobulin antibody, Anti-Beta 2 Microglobulin antibody, Hdcma22p protein, Beta 2 microglobulin precursor protein, Beta Microglobulin-2 antibody, Beta Microglobulin 2 antibody, Beta 2 Microglobulin, Beta Microglobulin 2, B2M antibody, Beta Microglobulin-2, Beta-2-Microglobulin antibody, Beta chain of mhc class 1 proteins protein
Specificity beta 2 Microglobulin antibody was raised against the N terminal of B2M
Cross Reactivity Human
Applications WB
Immunogen beta 2 Microglobulin antibody was raised using the N terminal of B2M corresponding to a region with amino acids MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF
Assay Information Beta 2 Microglobulin Blocking Peptide, catalog no. 33R-6492, is also available for use as a blocking control in assays to test for specificity of this Beta 2 Microglobulin antibody

Images

Western Blot analysis using Beta 2 Microglobulin antibody (70R-5904)

Beta 2 Microglobulin antibody (70R-5904) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 12 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of B2M antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a serum protein found in association with the major histocompatibility complex (MHC) class I heavy chain on the surface of nearly all nucleated cells.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Beta 2 Microglobulin antibody (70R-5904) | Beta 2 Microglobulin antibody (70R-5904) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors