Beta Lactamase 2 antibody (70R-4418)

Rabbit polyclonal Beta Lactamase 2 antibody raised against the middle region of LACTB2

Synonyms Polyclonal Beta Lactamase 2 antibody, Anti-Beta Lactamase 2 antibody, Lactamase Beta 2 antibody, LACTB2 antibody, CGI-83 antibody
Specificity Beta Lactamase 2 antibody was raised against the middle region of LACTB2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Beta Lactamase 2 antibody was raised using the middle region of LACTB2 corresponding to a region with amino acids NPQREEIIGNGEQQYVYLKDGDVIKTEGATLRVLYTPGHTDDHMALLLEE
Assay Information Beta Lactamase 2 Blocking Peptide, catalog no. 33R-6830, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase 2 antibody

Images

Western Blot analysis using Beta Lactamase 2 antibody (70R-4418)

Beta Lactamase 2 antibody (70R-4418) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LACTB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of LACTB2 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Beta Lactamase 2 antibody (70R-4418) | Beta Lactamase 2 antibody (70R-4418) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors