Beta Lactamase antibody (70R-2442)

Rabbit polyclonal Beta Lactamase antibody raised against the C terminal of LACTB

Synonyms Polyclonal Beta Lactamase antibody, Anti-Beta Lactamase antibody, FLJ14902 antibody, LACTB antibody, G24 antibody, Lactamase Beta antibody, MRPL56 antibody
Specificity Beta Lactamase antibody was raised against the C terminal of LACTB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL
Assay Information Beta Lactamase Blocking Peptide, catalog no. 33R-9050, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Images

Western Blot analysis using Beta Lactamase antibody (70R-2442)

Beta Lactamase antibody (70R-2442) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LACTB antibody in PBS

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Beta Lactamase antibody (70R-2442) | Beta Lactamase antibody (70R-2442) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors