Beta Tubulin antibody (70R-6025)

Rabbit polyclonal Beta Tubulin antibody raised against the N terminal of TUBB

Synonyms Polyclonal Beta Tubulin antibody, Anti-Beta Tubulin antibody, MGC117247 antibody, OK/SW-cl.56 antibody, TUBB1 antibody, M40 antibody, TUBB5 antibody, TUBB antibody, MGC16435 antibody
Specificity Beta Tubulin antibody was raised against the N terminal of TUBB
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Beta Tubulin antibody was raised using the N terminal of TUBB corresponding to a region with amino acids YHGDSDLQLDRISVYYNEATGGKYVPRAILVDLEPGTMDSVRSGPFGQIF
Assay Information Beta Tubulin Blocking Peptide, catalog no. 33R-10122, is also available for use as a blocking control in assays to test for specificity of this Beta Tubulin antibody

Images

Western Blot analysis using Beta Tubulin antibody (70R-6025)

Beta Tubulin antibody (70R-6025) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TUBB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance TUBB belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Beta Tubulin antibody (70R-6025) | Beta Tubulin antibody (70R-6025) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors