BFSP1 antibody (70R-4876)

Rabbit polyclonal BFSP1 antibody raised against the N terminal of BFSP1

Synonyms Polyclonal BFSP1 antibody, Anti-BFSP1 antibody, Beaded Filament Structural Protein 1 Filensin antibody, CP94 antibody, LIFL-H antibody, FILENSIN antibody, CP115 antibody
Specificity BFSP1 antibody was raised against the N terminal of BFSP1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BFSP1 antibody was raised using the N terminal of BFSP1 corresponding to a region with amino acids QVESNRQRVRDLEAERARLERQGTEAQRALDEFRSKYENECECQLLLKEM
Assay Information BFSP1 Blocking Peptide, catalog no. 33R-7771, is also available for use as a blocking control in assays to test for specificity of this BFSP1 antibody

Images

Western Blot analysis using BFSP1 antibody (70R-4876)

BFSP1 antibody (70R-4876) used at 0.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BFSP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and BFSP1 (or CP115), are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BFSP1 antibody (70R-4876) | BFSP1 antibody (70R-4876) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors