BHMT antibody (70R-1175)

Rabbit polyclonal BHMT antibody raised against the C terminal of BHMT

Synonyms Polyclonal BHMT antibody, Anti-BHMT antibody, Betaine-Homocysteine Methyltransferase antibody
Specificity BHMT antibody was raised against the C terminal of BHMT
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen BHMT antibody was raised using the C terminal of BHMT corresponding to a region with amino acids KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
Assay Information BHMT Blocking Peptide, catalog no. 33R-4414, is also available for use as a blocking control in assays to test for specificity of this BHMT antibody

Images

Western Blot analysis using BHMT antibody (70R-1175)

BHMT antibody (70R-1175) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of BHMT antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BHMT is a cytosolic enzyme that catalyzes the conversion of betaine and homocysteine to dimethylglycine and methionine, respectively. Defects in its gene could lead to hyperhomocyst(e)inemia, but such a defect has not yet been observed.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BHMT antibody (70R-1175) | BHMT antibody (70R-1175) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using BHMT antibody (70R-1175) | BHMT antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors