BMP2K antibody (70R-2021)

Rabbit polyclonal BMP2K antibody raised against the middle region of BMP2K

Synonyms Polyclonal BMP2K antibody, Anti-BMP2K antibody, BMP2K, DKFZp434P0116 antibody, BMPK 2 antibody, BMPK-2 antibody, BMPK-2, Bmp2 Inducible Kinase antibody, BIKE antibody, BMPK 2, HRIHFB2017 antibody, DKFZp434K0614 antibody
Specificity BMP2K antibody was raised against the middle region of BMP2K
Cross Reactivity Human,Mouse
Applications WB
Immunogen BMP2K antibody was raised using the middle region of BMP2K corresponding to a region with amino acids VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD
Assay Information BMP2K Blocking Peptide, catalog no. 33R-9640, is also available for use as a blocking control in assays to test for specificity of this BMP2K antibody


Western Blot analysis using BMP2K antibody (70R-2021)

BMP2K antibody (70R-2021) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 74 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BMP2K antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BMP2K is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. BMP2K is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BMP2K antibody (70R-2021) | BMP2K antibody (70R-2021) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors