BMP6 antibody (70R-6201)

Rabbit polyclonal BMP6 antibody raised against the middle region of BMP6

Synonyms Polyclonal BMP6 antibody, Anti-BMP6 antibody, BMP6, BMP-6 antibody, VGR antibody, BMP 6, Bone Morphogenetic Protein 6 antibody, VGR1 antibody, BMP 6 antibody, BMP-6
Specificity BMP6 antibody was raised against the middle region of BMP6
Cross Reactivity Human
Applications WB
Immunogen BMP6 antibody was raised using the middle region of BMP6 corresponding to a region with amino acids MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL
Assay Information BMP6 Blocking Peptide, catalog no. 33R-6576, is also available for use as a blocking control in assays to test for specificity of this BMP6 antibody

Images

Western Blot analysis using BMP6 antibody (70R-6201)

BMP6 antibody (70R-6201) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BMP6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The bone morphogenetic proteins (BMPs) are a family of secreted signaling molecules that can induce ectopic bone growth. Many BMPs are part of the transforming growth factor-beta (TGFB) superfamily.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BMP6 antibody (70R-6201) | BMP6 antibody (70R-6201) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors