BOLL antibody (70R-4749)

Rabbit polyclonal BOLL antibody

Synonyms Polyclonal BOLL antibody, Anti-BOLL antibody, Bol Boule-Like antibody
Cross Reactivity Human
Applications WB
Immunogen BOLL antibody was raised using a synthetic peptide corresponding to a region with amino acids GGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQ
Assay Information BOLL Blocking Peptide, catalog no. 33R-3288, is also available for use as a blocking control in assays to test for specificity of this BOLL antibody


Western Blot analysis using BOLL antibody (70R-4749)

BOLL antibody (70R-4749) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BOLL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene belongs to the DAZ gene family required for germ cell development. BOLL is an RNA-binding protein which is more similar to Drosophila Boule than to human proteins encoded by genes DAZ (deleted in azoospermia) or DAZL (deleted in azoospermia-like). Loss of this gene function results in the absence of sperm in semen (azoospermia). Histological studies demonstrated that the primary defect is at the meiotic G2/M transition.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BOLL antibody (70R-4749) | BOLL antibody (70R-4749) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors