BRI3BP antibody (70R-7252)

Rabbit polyclonal BRI3BP antibody raised against the C terminal of BRI3BP

Synonyms Polyclonal BRI3BP antibody, Anti-BRI3BP antibody, HCCR-2 antibody, BNAS1 antibody, Bri3 Binding Protein antibody, KG19 antibody, BRI3BP, BRIBP 3, BRIBP 3 antibody, BRIBP-3 antibody, BRIBP-3
Specificity BRI3BP antibody was raised against the C terminal of BRI3BP
Cross Reactivity Human
Applications WB
Immunogen BRI3BP antibody was raised using the C terminal of BRI3BP corresponding to a region with amino acids GFYWRSSPSGPSNPSNPSVEEKLEHLEKQVRLLNIRLNRVLESLDRSKDK
Assay Information BRI3BP Blocking Peptide, catalog no. 33R-3270, is also available for use as a blocking control in assays to test for specificity of this BRI3BP antibody

Images

Western Blot analysis using BRI3BP antibody (70R-7252)

BRI3BP antibody (70R-7252) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRI3BP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance BRI3BP is involved in the structural dynamics of the ER and affects mitochondrial viability.It is widely expressed in animal cell types, that seems to possess a pro-apoptotic property and can potentiate drug-induced apoptosis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BRI3BP antibody (70R-7252) | BRI3BP antibody (70R-7252) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors