BRUNOL4 antibody (70R-4776)

Rabbit polyclonal BRUNOL4 antibody

Synonyms Polyclonal BRUNOL4 antibody, Anti-BRUNOL4 antibody, Bruno-Like 4 Rna Binding Protein antibody, CELF4 antibody, BRUNOL-4 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen BRUNOL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PMAAFAAAQMQQMAALNMNGLAAAPMTPTSGGSTPPGITAPAVPSIPSPI
Assay Information BRUNOL4 Blocking Peptide, catalog no. 33R-7218, is also available for use as a blocking control in assays to test for specificity of this BRUNOL4 antibody

Images

Western Blot analysis using BRUNOL4 antibody (70R-4776)

BRUNOL4 antibody (70R-4776) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRUNOL4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using BRUNOL4 antibody (70R-4776) | BRUNOL4 antibody (70R-4776) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors