BRUNOL5 antibody (70R-4930)

Rabbit polyclonal BRUNOL5 antibody raised against the middle region of BRUNOL5

Synonyms Polyclonal BRUNOL5 antibody, Anti-BRUNOL5 antibody, CELF5 antibody, BRUNOL-5 antibody, Cugbp Elav-Like Family Member 5 antibody
Specificity BRUNOL5 antibody was raised against the middle region of BRUNOL5
Cross Reactivity Human
Applications WB
Immunogen BRUNOL5 antibody was raised using the middle region of BRUNOL5 corresponding to a region with amino acids GVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPT
Assay Information BRUNOL5 Blocking Peptide, catalog no. 33R-3659, is also available for use as a blocking control in assays to test for specificity of this BRUNOL5 antibody


Western Blot analysis using BRUNOL5 antibody (70R-4930)

BRUNOL5 antibody (70R-4930) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of BRUNOL5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternatively spliced transcript variants have been identified in this gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using BRUNOL5 antibody (70R-4930) | BRUNOL5 antibody (70R-4930) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors